27tjerrell 27tjerrell
  • 01-04-2021
  • Mathematics
contestada

J is 25 more than 3
what does j equal.

Respuesta :

daharis0116 daharis0116
  • 01-04-2021

J would equal 28 because 28 is 25 more than 3. Although worded differently, all you have to do is add 3 and 25.
Answer Link
hundegetnet
hundegetnet hundegetnet
  • 01-04-2021

Answer:

jjlllllllllllslllllekkkkkkkkkkkkkkkkkkkkksnnnnnnnnnngllllljkkk

Step-by-step explanation:

kkkkkkkdkkkkkxuuuuusgggggggawwwwwwkpppgyyyyyfgggklllllllf

Answer Link

Otras preguntas

where might a pronoun’s antecedent appear?
Most infants are able to crawl and speak a few words by the time they___ are . a. 18 b. 10 c. 3
Which of the following statements about irony is false? a. irony is a difference between appearances and reality. b. verbal irony is when there is a differenc
The one-to-one functions g and h are defines as follows. g={(-7,-9),(-2,8),(2,-7),(3,2)} h(x)=3x-10 Find the following. g^-1 (2)=_____ h^-1 (x)= ______ (h•h^-1)
54 decreased by twice a number
What's figurative language
which component of physical fitness is skill related ?
Please help! Calculate the average rate of change for the graphed sequence from n=1 to n=5?
Type the formula for the number of combinations of n things taken r at a time. C(n, r) =
The United States and Soviet Union signed ______________ during George H. Bush's administration